Recombinant Human DNAL1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens dynein axonemal light chain 1 (DNAL1), transcript variant 1 (NM_031427).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q4LDG9
Entry Name DNAL1_HUMAN
Gene Names DNAL1 C14orf168
Alternative Gene Names C14orf168
Alternative Protein Names Dynein axonemal light chain 1 (LC1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 190
Molecular Weight(Da) 21533
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN
Background
Function FUNCTION: Part of the multisubunit axonemal ATPase complexes that generate the force for cilia motility and govern beat frequency (By similarity). Component of the outer arm dynein (ODA). May be involved in a mechanosensory feedback mechanism controlling ODA activity based on external conformational cues by tethering the outer arm dynein heavy chain (DNAH5) to the microtubule within the axoneme (By similarity). Important for ciliary function in the airways and for the function of the cilia that produce the nodal flow essential for the determination of the left-right asymmetry (PubMed:21496787). {ECO:0000250|UniProtKB:Q9XHH2, ECO:0000303|PubMed:21496787}.
Pathway
Protein Families Dynein light chain LC1-type family
Tissue Specificity Expressed in tissues carrying motile cilia such as respiratory epithelia, ependyma and testis. {ECO:0000269|PubMed:15845866}.
QC Data
Please contact us for specific QC data.
$389.00
In stock
SKU
EB-EPE8281726

Recombinant Human DNAL1 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human DNAL1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.